PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 356aa    MW: 39690 Da    PI: 6.6879
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096000.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-092823162155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+ +gL+++q+ +WF N+R ++
  XP_011096000.1 282 KWPYPSEAQKLALAEATGLDQKQINNWFINQRKRH 316
                     569*****************************885 PP

2ELK41.13.6e-14236257122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  XP_011096000.1 236 ELKGQLLRKYSGYLGSLKQEFM 257
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.3E-1992136IPR005540KNOX1
PfamPF037902.1E-2294132IPR005540KNOX1
SMARTSM012563.2E-20141192IPR005541KNOX2
PfamPF037911.1E-18145184IPR005541KNOX2
SMARTSM011882.8E-8236257IPR005539ELK domain
PROSITE profilePS5121311.174236256IPR005539ELK domain
PfamPF037895.9E-11236257IPR005539ELK domain
PROSITE profilePS5007112.843256319IPR001356Homeobox domain
SuperFamilySSF466898.13E-20258332IPR009057Homeodomain-like
SMARTSM003898.6E-13258323IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-27261321IPR009057Homeodomain-like
CDDcd000862.17E-12268320No hitNo description
PfamPF059205.6E-17276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MESGGGSSSS SCFLAFGENN NLFCPIMMMP SMVSSHHPNA DSGNNLFLPL PSTNRHGSTG  60
GGAGSSMMLQ DQHNNTSTGY YFMESSNDAG SCSVKAKIMG HPHYPRLLAA YVNCQKIGAP  120
PEVVARLEEA CASAAANRPH GTSCVGEDPA LDQFMEAYCE MLTKYEQELS KPFKEAMLFL  180
SRINFYIRSL LISHCLCCCS AHSLAACAEA MERNASSEEE VDVNNSFIDP QAEDQELKGQ  240
LLRKYSGYLG SLKQEFMKKR KKGKLPKEAR QQLLDWWTRH YKWPYPSEAQ KLALAEATGL  300
DQKQINNWFI NQRKRHWKPS EDMQFVVMDA GHPNYYMDHV LGNPFPMDIS TAPALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251260LKQEFMKKRK
2257261KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096000.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-142HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLQ5XLC91e-175Q5XLC9_POPCN; Homeodomain protein ARBORKNOX1
STRINGVIT_10s0116g00190.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68352433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-121KNOX/ELK homeobox transcription factor